Lineage for d1im4a_ (1im4 A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1951566Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1951567Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1952995Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 1952996Protein DinB homolog (DBH) [100889] (3 species)
  7. 1953001Species Sulfolobus solfataricus [TaxId:2287] [100891] (3 PDB entries)
  8. 1953002Domain d1im4a_: 1im4 A: [62581]
    "palm" and "fingers" domains only
    complexed with so4

Details for d1im4a_

PDB Entry: 1im4 (more details), 2.3 Å

PDB Description: Crystal Structure of a DinB Homolog (DBH) Lesion Bypass DNA Polymerase Catalytic Fragment from Sulfolobus solfataricus
PDB Compounds: (A:) dbh

SCOPe Domain Sequences for d1im4a_:

Sequence, based on SEQRES records: (download)

>d1im4a_ e.8.1.7 (A:) DinB homolog (DBH) {Sulfolobus solfataricus [TaxId: 2287]}
hhhhhivifvdfdyffaqveevlnpqykgkplvvcvysgrtktsgavatanyearklgvk
agmpiikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkve
gnfengielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdfl
neldideipgigsvlarrlnelgiqklrd

Sequence, based on observed residues (ATOM records): (download)

>d1im4a_ e.8.1.7 (A:) DinB homolog (DBH) {Sulfolobus solfataricus [TaxId: 2287]}
hhhhhivifvdfdyffaqveevlnpqykgkplvvcvystsgavatanyearklgvkagmp
iikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfe
ngielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneld
ideipgigsvlarrlnelgiqklrd

SCOPe Domain Coordinates for d1im4a_:

Click to download the PDB-style file with coordinates for d1im4a_.
(The format of our PDB-style files is described here.)

Timeline for d1im4a_: