Lineage for d1im4a1 (1im4 A:2-205)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3018090Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3018091Protein DinB homolog (DBH) [100889] (3 species)
  7. 3018096Species Sulfolobus solfataricus [TaxId:2287] [100891] (3 PDB entries)
  8. 3018097Domain d1im4a1: 1im4 A:2-205 [62581]
    Other proteins in same PDB: d1im4a2
    "palm" and "fingers" domains only
    complexed with so4

Details for d1im4a1

PDB Entry: 1im4 (more details), 2.3 Å

PDB Description: Crystal Structure of a DinB Homolog (DBH) Lesion Bypass DNA Polymerase Catalytic Fragment from Sulfolobus solfataricus
PDB Compounds: (A:) dbh

SCOPe Domain Sequences for d1im4a1:

Sequence, based on SEQRES records: (download)

>d1im4a1 e.8.1.7 (A:2-205) DinB homolog (DBH) {Sulfolobus solfataricus [TaxId: 2287]}
ivifvdfdyffaqveevlnpqykgkplvvcvysgrtktsgavatanyearklgvkagmpi
ikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfen
gielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneldi
deipgigsvlarrlnelgiqklrd

Sequence, based on observed residues (ATOM records): (download)

>d1im4a1 e.8.1.7 (A:2-205) DinB homolog (DBH) {Sulfolobus solfataricus [TaxId: 2287]}
ivifvdfdyffaqveevlnpqykgkplvvcvystsgavatanyearklgvkagmpiikam
qiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfengiel
arkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneldideip
gigsvlarrlnelgiqklrd

SCOPe Domain Coordinates for d1im4a1:

Click to download the PDB-style file with coordinates for d1im4a1.
(The format of our PDB-style files is described here.)

Timeline for d1im4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1im4a2