Lineage for d1im3p_ (1im3 P:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789367Family b.1.18.5: Cytomegalovirus protein US2 [81285] (1 protein)
  6. 789368Protein Cytomegalovirus protein US2 [63668] (1 species)
    similar to both C1 and C2 set
  7. 789369Species Human cytomegalovirus [TaxId:10359] [63669] (1 PDB entry)
  8. 789373Domain d1im3p_: 1im3 P: [62580]
    Other proteins in same PDB: d1im3a1, d1im3a2, d1im3b_, d1im3e1, d1im3e2, d1im3f_, d1im3i1, d1im3i2, d1im3j_, d1im3m1, d1im3m2, d1im3n_

Details for d1im3p_

PDB Entry: 1im3 (more details), 2.2 Å

PDB Description: Crystal Structure of the human cytomegalovirus protein US2 bound to the MHC class I molecule HLA-A2/tax
PDB Compounds: (P:) cytomegalovirus protein US2

SCOP Domain Sequences for d1im3p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1im3p_ b.1.18.5 (P:) Cytomegalovirus protein US2 {Human cytomegalovirus [TaxId: 10359]}
pwfqiednrcyidngklfargsivgnmsrfvfdpkadyggvgenlyvhaddvefvpgesl
kwnvrnldvmpifetlalrlvlqgdviwlrcvpel

SCOP Domain Coordinates for d1im3p_:

Click to download the PDB-style file with coordinates for d1im3p_.
(The format of our PDB-style files is described here.)

Timeline for d1im3p_: