Lineage for d1im3p_ (1im3 P:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160911Family b.1.1.6: Internalin Ig-like domain [68902] (5 proteins)
  6. 160915Protein Cytomegalovirus protein US2 [63668] (1 species)
  7. 160916Species Human cytomegalovirus [TaxId:10359] [63669] (1 PDB entry)
  8. 160920Domain d1im3p_: 1im3 P: [62580]
    Other proteins in same PDB: d1im3a1, d1im3a2, d1im3b1, d1im3e1, d1im3e2, d1im3f1, d1im3i1, d1im3i2, d1im3j1, d1im3m1, d1im3m2, d1im3n1

Details for d1im3p_

PDB Entry: 1im3 (more details), 2.2 Å

PDB Description: Crystal Structure of the human cytomegalovirus protein US2 bound to the MHC class I molecule HLA-A2/tax

SCOP Domain Sequences for d1im3p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1im3p_ b.1.1.6 (P:) Cytomegalovirus protein US2 {Human cytomegalovirus}
pwfqiednrcyidngklfargsivgnmsrfvfdpkadyggvgenlyvhaddvefvpgesl
kwnvrnldvmpifetlalrlvlqgdviwlrcvpel

SCOP Domain Coordinates for d1im3p_:

Click to download the PDB-style file with coordinates for d1im3p_.
(The format of our PDB-style files is described here.)

Timeline for d1im3p_: