Lineage for d1im3m2 (1im3 M:1-181)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719393Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 719406Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (62 PDB entries)
  8. 719453Domain d1im3m2: 1im3 M:1-181 [62578]
    Other proteins in same PDB: d1im3a1, d1im3b_, d1im3d_, d1im3e1, d1im3f_, d1im3h_, d1im3i1, d1im3j_, d1im3l_, d1im3m1, d1im3n_, d1im3p_

Details for d1im3m2

PDB Entry: 1im3 (more details), 2.2 Å

PDB Description: Crystal Structure of the human cytomegalovirus protein US2 bound to the MHC class I molecule HLA-A2/tax
PDB Compounds: (M:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOP Domain Sequences for d1im3m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1im3m2 d.19.1.1 (M:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1im3m2:

Click to download the PDB-style file with coordinates for d1im3m2.
(The format of our PDB-style files is described here.)

Timeline for d1im3m2: