Lineage for d1im3i1 (1im3 I:182-275)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 52919Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 52936Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (24 PDB entries)
  8. 52955Domain d1im3i1: 1im3 I:182-275 [62573]
    Other proteins in same PDB: d1im3a2, d1im3d_, d1im3e2, d1im3h_, d1im3i2, d1im3l_, d1im3m2, d1im3p_

Details for d1im3i1

PDB Entry: 1im3 (more details), 2.2 Å

PDB Description: Crystal Structure of the human cytomegalovirus protein US2 bound to the MHC class I molecule HLA-A2/tax

SCOP Domain Sequences for d1im3i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1im3i1 b.1.1.2 (I:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOP Domain Coordinates for d1im3i1:

Click to download the PDB-style file with coordinates for d1im3i1.
(The format of our PDB-style files is described here.)

Timeline for d1im3i1: