SCOP 1.63: Domain d1im3e2: 1im3 E:1-181

Lineage for d1im3e2 (1im3 E:1-181)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (27 PDB entries)

8. Domain d1im3e2: 1im3 E:1-181 [62570]
   Other proteins in same PDB: d1im3a1, d1im3b_, d1im3d_, d1im3e1, d1im3f_, d1im3h_, d1im3i1, d1im3j_, d1im3l_, d1im3m1, d1im3n_, d1im3p_

Details for d1im3e2

PDB Entry: 1im3, 2.2 Å

PDB Description: Crystal Structure of the human cytomegalovirus protein US2 bound to the MHC class I molecule HLA-A2/tax

SCOP Domain Sequences for d1im3e2:

Sequence; same for both SEQRES and ATOM records:

>d1im3e2 d.19.1.1 (E:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1im3e2:

• d1im3e2 first appeared in SCOP 1.57
  
• d1im3e2 appears in SCOP 1.61
  
• d1im3e2 appears in SCOP 1.65
  
• d1im3e2 appears in the current release, SCOPe 2.08