Lineage for d1im3d_ (1im3 D:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223262Superfamily b.1.18: E set domains [81296] (17 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 223465Family b.1.18.5: Cytomegalovirus protein US2 [81285] (1 protein)
  6. 223466Protein Cytomegalovirus protein US2 [63668] (1 species)
    similar to both C1 and C2 set
  7. 223467Species Human cytomegalovirus [TaxId:10359] [63669] (1 PDB entry)
  8. 223468Domain d1im3d_: 1im3 D: [62568]
    Other proteins in same PDB: d1im3a1, d1im3a2, d1im3b_, d1im3e1, d1im3e2, d1im3f_, d1im3i1, d1im3i2, d1im3j_, d1im3m1, d1im3m2, d1im3n_

Details for d1im3d_

PDB Entry: 1im3 (more details), 2.2 Å

PDB Description: Crystal Structure of the human cytomegalovirus protein US2 bound to the MHC class I molecule HLA-A2/tax

SCOP Domain Sequences for d1im3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1im3d_ b.1.18.5 (D:) Cytomegalovirus protein US2 {Human cytomegalovirus}
pwfqiednrcyidngklfargsivgnmsrfvfdpkadyggvgenlyvhaddvefvpgesl
kwnvrnldvmpifetlalrlvlqgdviwlrcvpel

SCOP Domain Coordinates for d1im3d_:

Click to download the PDB-style file with coordinates for d1im3d_.
(The format of our PDB-style files is described here.)

Timeline for d1im3d_: