Lineage for d1im2a_ (1im2 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 180169Family c.37.1.13: Extended AAA-ATPase domain [52700] (17 proteins)
  6. 180232Protein HslU [52721] (2 species)
  7. 180262Species Haemophilus influenzae [TaxId:727] [52723] (4 PDB entries)
  8. 180264Domain d1im2a_: 1im2 A: [62564]

Details for d1im2a_

PDB Entry: 1im2 (more details), 2.8 Å

PDB Description: HslU, Haemophilus Influenzae, Selenomethionine Variant
PDB Compounds: (A:)

SCOP Domain Sequences for d1im2a_:

Sequence, based on SEQRES records: (download)

>d1im2a_ c.37.1.13 (A:) HslU {Haemophilus influenzae}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
daayvadalgevvenedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1im2a_ c.37.1.13 (A:) HslU {Haemophilus influenzae}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
raedvaeerliddeaaklinpeelkqkaidaveqngivfideidkickeysgadvsregv
qrdllplvegstvstkhgmvktdhilfiasgafqvarpsdlipelqgrlpirveltalsa
adferiltephaslteqykalmategvniafttdavkkiaeaafrvnektenigarrlht
vmerlmdkisfsasdmngqtvnidaayvadalgevvenedlsrfil

SCOP Domain Coordinates for d1im2a_:

Click to download the PDB-style file with coordinates for d1im2a_.
(The format of our PDB-style files is described here.)

Timeline for d1im2a_: