Lineage for d1im2a_ (1im2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113456Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 protein domains)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2113595Protein HslU [52721] (2 species)
    ATPase subunit of ATP-dependent protease
  7. 2113629Species Haemophilus influenzae [TaxId:727] [52723] (6 PDB entries)
  8. 2113634Domain d1im2a_: 1im2 A: [62564]
    complexed with adp, so4

Details for d1im2a_

PDB Entry: 1im2 (more details), 2.8 Å

PDB Description: HslU, Haemophilus Influenzae, Selenomethionine Variant
PDB Compounds: (A:) ATP-dependent hsl protease ATP-binding subunit hslu

SCOPe Domain Sequences for d1im2a_:

Sequence, based on SEQRES records: (download)

>d1im2a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
daayvadalgevvenedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1im2a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
raedvaeerliddeaaklinpeelkqkaidaveqngivfideidkickeysgadvsregv
qrdllplvegstvstkhgmvktdhilfiasgafqvarpsdlipelqgrlpirveltalsa
adferiltephaslteqykalmategvniafttdavkkiaeaafrvnektenigarrlht
vmerlmdkisfsasdmngqtvnidaayvadalgevvenedlsrfil

SCOPe Domain Coordinates for d1im2a_:

Click to download the PDB-style file with coordinates for d1im2a_.
(The format of our PDB-style files is described here.)

Timeline for d1im2a_: