Lineage for d1il1b1 (1il1 B:1-112)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51760Species Anti-HIV Fab G3-519, (mouse), kappa L chain [63642] (1 PDB entry)
  8. 51762Domain d1il1b1: 1il1 B:1-112 [62541]
    Other proteins in same PDB: d1il1a2, d1il1b2

Details for d1il1b1

PDB Entry: 1il1 (more details), 2.2 Å

PDB Description: Crystal structure of G3-519, an anti-HIV monoclonal antibody

SCOP Domain Sequences for d1il1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1il1b1 b.1.1.1 (B:1-112) Immunoglobulin (variable domains of L and H chains) {Anti-HIV Fab G3-519, (mouse), kappa L chain}
divmsqspsslavsvgekvtmsckssqsllysrnqmnylswyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvkaedlavyycqqyyhyrtfgggtrleir

SCOP Domain Coordinates for d1il1b1:

Click to download the PDB-style file with coordinates for d1il1b1.
(The format of our PDB-style files is described here.)

Timeline for d1il1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1il1b2