Lineage for d1il1a2 (1il1 A:122-221)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159318Species Anti-HIV Fab G3-519, (mouse), kappa L chain [63654] (1 PDB entry)
  8. 159319Domain d1il1a2: 1il1 A:122-221 [62540]
    Other proteins in same PDB: d1il1a1, d1il1b1

Details for d1il1a2

PDB Entry: 1il1 (more details), 2.2 Å

PDB Description: Crystal structure of G3-519, an anti-HIV monoclonal antibody

SCOP Domain Sequences for d1il1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1il1a2 b.1.1.2 (A:122-221) Immunoglobulin (constant domains of L and H chains) {Anti-HIV Fab G3-519, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1il1a2:

Click to download the PDB-style file with coordinates for d1il1a2.
(The format of our PDB-style files is described here.)

Timeline for d1il1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1il1a1