Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Anti-HIV Fab G3-519, (mouse), kappa L chain [63642] (1 PDB entry) |
Domain d1il1a1: 1il1 A:3-121 [62539] Other proteins in same PDB: d1il1a2, d1il1b2 |
PDB Entry: 1il1 (more details), 2.2 Å
SCOP Domain Sequences for d1il1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1il1a1 b.1.1.1 (A:3-121) Immunoglobulin (variable domains of L and H chains) {Anti-HIV Fab G3-519, (mouse), kappa L chain} qlqqsgaelvrsgasvklscatsdfnikdyyihwvrqrpeqglewigwldpengdtesap kfqgkatmtadtssntaylqlssltseasavyycnaisttrdyyaldywgqgtsvtvss
Timeline for d1il1a1: