Lineage for d1ikca_ (1ikc A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890226Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 890227Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 890228Family g.7.1.1: Snake venom toxins [57303] (27 proteins)
  6. 890256Protein Bungarotoxin [57324] (4 species)
  7. 890257Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (22 PDB entries)
  8. 890264Domain d1ikca_: 1ikc A: [62526]
    complexed with a mimotope of the nicotinic acetylcholine receptor, chain B

Details for d1ikca_

PDB Entry: 1ikc (more details)

PDB Description: nmr structure of alpha-bungarotoxin
PDB Compounds: (A:) long neurotoxin 1

SCOP Domain Sequences for d1ikca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ikca_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]}
ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrpg

SCOP Domain Coordinates for d1ikca_:

Click to download the PDB-style file with coordinates for d1ikca_.
(The format of our PDB-style files is described here.)

Timeline for d1ikca_: