SCOP 1.57: Domain d1ik4f_: 1ik4 F:

Lineage for d1ik4f_ (1ik4 F:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)

4. Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families)

5. Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (1 protein)

6. Protein Methylglyoxal synthase, MgsA [52340] (1 species)

7. Species Escherichia coli [TaxId:562] [52341] (3 PDB entries)

8. Domain d1ik4f_: 1ik4 F: [62524]

Details for d1ik4f_

PDB Entry: 1ik4, 2 Å

PDB Description: X-ray Structure of Methylglyoxal Synthase from E. coli Complexed with Phosphoglycolohydroxamic Acid

SCOP Domain Sequences for d1ik4f_:

Sequence; same for both SEQRES and ATOM records:

>d1ik4f_ c.24.1.2 (F:) Methylglyoxal synthase, MgsA {Escherichia coli}
melttrtlparkhialvahdhckqmlmswverhqplleqhvlyatgttgnlisratgmnv
namlsgpmggdqqvgalisegkidvliffwdplnavphdpdvkallrlatvwnipvatnv
atadfiiqsphfndavdilipdyqryladrl

Timeline for d1ik4f_:

• d1ik4f_ is new in SCOP 1.57
  
• d1ik4f_ appears in SCOP 1.59
  
• d1ik4f_ appears in the current release, SCOPe 2.08