Lineage for d1ik4b_ (1ik4 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467829Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2467830Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) (S)
    contains a common phosphate-binding site
  5. 2467874Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins)
  6. 2467875Protein Methylglyoxal synthase, MgsA [52340] (3 species)
  7. 2467876Species Escherichia coli [TaxId:562] [52341] (5 PDB entries)
  8. 2467881Domain d1ik4b_: 1ik4 B: [62520]
    complexed with phosphoglycolohydroxamic acid
    complexed with pgh

Details for d1ik4b_

PDB Entry: 1ik4 (more details), 2 Å

PDB Description: X-ray Structure of Methylglyoxal Synthase from E. coli Complexed with Phosphoglycolohydroxamic Acid
PDB Compounds: (B:) methylglyoxal synthase

SCOPe Domain Sequences for d1ik4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ik4b_ c.24.1.2 (B:) Methylglyoxal synthase, MgsA {Escherichia coli [TaxId: 562]}
melttrtlparkhialvahdhckqmlmswverhqplleqhvlyatgttgnlisratgmnv
namlsgpmggdqqvgalisegkidvliffwdplnavphdpdvkallrlatvwnipvatnv
atadfiiqsphfndavdilipdyqryladrl

SCOPe Domain Coordinates for d1ik4b_:

Click to download the PDB-style file with coordinates for d1ik4b_.
(The format of our PDB-style files is described here.)

Timeline for d1ik4b_: