Lineage for d1ijya_ (1ijy A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2340309Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
    Core: 3 helices; irregular array; disulfide-rich
  4. 2340310Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) (S)
    automatically mapped to Pfam PF01392
  5. 2340311Family a.141.1.1: Frizzled cysteine-rich domain [63502] (3 protein domains)
  6. 2340312Protein Frizzled 8 (FZ8) [63505] (1 species)
  7. 2340313Species Mouse (Mus musculus) [TaxId:10090] [63506] (1 PDB entry)
  8. 2340314Domain d1ijya_: 1ijy A: [62517]

Details for d1ijya_

PDB Entry: 1ijy (more details), 1.35 Å

PDB Description: crystal structure of the cysteine-rich domain of mouse frizzled 8 (mfz8)
PDB Compounds: (A:) frizzled homolog 8

SCOPe Domain Sequences for d1ijya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijya_ a.141.1.1 (A:) Frizzled 8 (FZ8) {Mouse (Mus musculus) [TaxId: 10090]}
elacqeitvplckgigyeytympnqfnhdtqdeaglevhqfwplveiqcspdlkfflcsm
ytpicledykkplppcrsvcerakagcaplmrqygfawpdrmrcdrlpeqgnpdtlcmdy
er

SCOPe Domain Coordinates for d1ijya_:

Click to download the PDB-style file with coordinates for d1ijya_.
(The format of our PDB-style files is described here.)

Timeline for d1ijya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ijyb_