![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.1: Cytokine [50353] (2 families) ![]() |
![]() | Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins) |
![]() | Protein Fibroblast growth factor 4 (FGF4) [63779] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63780] (1 PDB entry) |
![]() | Domain d1ijta_: 1ijt A: [62510] complexed with so4; mutant |
PDB Entry: 1ijt (more details), 1.8 Å
SCOP Domain Sequences for d1ijta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ijta_ b.42.1.1 (A:) Fibroblast growth factor 4 (FGF4) {Human (Homo sapiens) [TaxId: 9606]} gikrlrrlycnvgigfhlqalpdgriggahadtrdsllelspvergvvsifgvasrffva msskgklygspfftdectfkeillpnnynayesykypgmfialgkngktkkgnrvsptmk vthflprl
Timeline for d1ijta_: