Lineage for d1ijta_ (1ijt A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 59852Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 59853Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 59854Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins)
  6. 59919Protein Fibroblast growth factor 4 (FGF4) [63779] (1 species)
  7. 59920Species Human (Homo sapiens) [TaxId:9606] [63780] (1 PDB entry)
  8. 59921Domain d1ijta_: 1ijt A: [62510]

Details for d1ijta_

PDB Entry: 1ijt (more details), 1.8 Å

PDB Description: crystal structure of fibroblast growth factor 4 (fgf4)

SCOP Domain Sequences for d1ijta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijta_ b.42.1.1 (A:) Fibroblast growth factor 4 (FGF4) {Human (Homo sapiens)}
gikrlrrlycnvgigfhlqalpdgriggahadtrdsllelspvergvvsifgvasrffva
msskgklygspfftdectfkeillpnnynayesykypgmfialgkngktkkgnrvsptmk
vthflprl

SCOP Domain Coordinates for d1ijta_:

Click to download the PDB-style file with coordinates for d1ijta_.
(The format of our PDB-style files is described here.)

Timeline for d1ijta_: