Lineage for d1ijqa1 (1ijq A:377-642)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2065610Superfamily b.68.5: YWTD domain [63825] (1 family) (S)
  5. 2065611Family b.68.5.1: YWTD domain [63826] (2 protein domains)
  6. 2065612Protein Low density lipoprotein (LDL) receptor [63827] (1 species)
  7. 2065613Species Human (Homo sapiens) [TaxId:9606] [63828] (2 PDB entries)
  8. 2065614Domain d1ijqa1: 1ijq A:377-642 [62506]
    Other proteins in same PDB: d1ijqa2, d1ijqb2

Details for d1ijqa1

PDB Entry: 1ijq (more details), 1.5 Å

PDB Description: Crystal Structure of the LDL Receptor YWTD-EGF Domain Pair
PDB Compounds: (A:) low-density lipoprotein receptor

SCOPe Domain Sequences for d1ijqa1:

Sequence, based on SEQRES records: (download)

>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]}
iaylfftnrhevrkmtldrseytslipnlrnvvaldtevasnriywsdlsqrmicstqld
rahgvssydtvisrdiqapdglavdwihsniywtdsvlgtvsvadtkgvkrktlfrengs
kpraivvdpvhgfmywtdwgtpakikkgglngvdiyslvteniqwpngitldllsgrlyw
vdsklhsissidvnggnrktiledekrlahpfslavfedkvfwtdiineaifsanrltgs
dvnllaenllspedmvlfhnltqprg

Sequence, based on observed residues (ATOM records): (download)

>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]}
iaylfftnrhevrkmtldrseytslipnlrnvvaldtevasnriywsdlsqrmicstqly
dtvisrdiqapdglavdwihsniywtdsvlgtvsvadtkgvkrktlfrengskpraivvd
pvhgfmywtdwgtpakikkgglngvdiyslvteniqwpngitldllsgrlywvdsklhsi
ssidvnggnrktiledekrlahpfslavfedkvfwtdiineaifsanrltgsdvnllaen
llspedmvlfhnltqprg

SCOPe Domain Coordinates for d1ijqa1:

Click to download the PDB-style file with coordinates for d1ijqa1.
(The format of our PDB-style files is described here.)

Timeline for d1ijqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ijqa2