![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.12: eEF-1beta-like [54984] (1 family) ![]() automatically mapped to Pfam PF00736 |
![]() | Family d.58.12.1: eEF-1beta-like [54985] (3 proteins) |
![]() | Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (7 PDB entries) |
![]() | Domain d1ijfb_: 1ijf B: [62492] Other proteins in same PDB: d1ijfa1, d1ijfa2, d1ijfa3 complexed with gdp, mg |
PDB Entry: 1ijf (more details), 3 Å
SCOPe Domain Sequences for d1ijfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ijfb_ d.58.12.1 (B:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved dkvslddlqqsieededhvqstdiaamqkl
Timeline for d1ijfb_: