Lineage for d1ijfb_ (1ijf B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196596Superfamily d.58.12: eEF-1beta-like [54984] (1 family) (S)
    automatically mapped to Pfam PF00736
  5. 2196597Family d.58.12.1: eEF-1beta-like [54985] (3 proteins)
  6. 2196601Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species)
  7. 2196602Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (7 PDB entries)
  8. 2196609Domain d1ijfb_: 1ijf B: [62492]
    Other proteins in same PDB: d1ijfa1, d1ijfa2, d1ijfa3
    complexed with gdp, mg

Details for d1ijfb_

PDB Entry: 1ijf (more details), 3 Å

PDB Description: Nucleotide exchange mechanisms in the eEF1A-eEF1Ba complex
PDB Compounds: (B:) elongation factor 1-beta

SCOPe Domain Sequences for d1ijfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijfb_ d.58.12.1 (B:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
dkvslddlqqsieededhvqstdiaamqkl

SCOPe Domain Coordinates for d1ijfb_:

Click to download the PDB-style file with coordinates for d1ijfb_.
(The format of our PDB-style files is described here.)

Timeline for d1ijfb_: