Lineage for d1ijfa2 (1ijf A:335-441)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403437Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403438Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2403439Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)
  6. 2403440Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 2403441Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50473] (6 PDB entries)
  8. 2403446Domain d1ijfa2: 1ijf A:335-441 [62490]
    Other proteins in same PDB: d1ijfa1, d1ijfa3, d1ijfb_
    complexed with gdp, mg

Details for d1ijfa2

PDB Entry: 1ijf (more details), 3 Å

PDB Description: Nucleotide exchange mechanisms in the eEF1A-eEF1Ba complex
PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d1ijfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijfa2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
casfnatvivlnhpgqisagyspvldchtahiacrfdellekndrrsgkkledhpkflks
gdaalvkfvpskpmcveafseypplgrfavrdmrqtvavgviksvdk

SCOPe Domain Coordinates for d1ijfa2:

Click to download the PDB-style file with coordinates for d1ijfa2.
(The format of our PDB-style files is described here.)

Timeline for d1ijfa2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ijfb_