SCOPe 2.08: Domain d1ijfa2: 1ijf A:335-441

Lineage for d1ijfa2 (1ijf A:335-441)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)

6. Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50473] (6 PDB entries)

8. Domain d1ijfa2: 1ijf A:335-441 [62490]
   Other proteins in same PDB: d1ijfa1, d1ijfa3, d1ijfb_
   complexed with gdp, mg

Details for d1ijfa2

PDB Entry: 1ijf, 3 Å

PDB Description: Nucleotide exchange mechanisms in the eEF1A-eEF1Ba complex

PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d1ijfa2:

Sequence; same for both SEQRES and ATOM records:

>d1ijfa2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
casfnatvivlnhpgqisagyspvldchtahiacrfdellekndrrsgkkledhpkflks
gdaalvkfvpskpmcveafseypplgrfavrdmrqtvavgviksvdk

Timeline for d1ijfa2:

• d1ijfa2 first appeared in SCOP 1.57
  
• d1ijfa2 appears in SCOPe 2.07