Class b: All beta proteins [48724] (177 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species) eukaryotic and archaeal homologue of EF-Tu |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50455] (6 PDB entries) |
Domain d1ijfa1: 1ijf A:241-334 [62489] Other proteins in same PDB: d1ijfa2, d1ijfa3, d1ijfb_ complexed with gdp, mg |
PDB Entry: 1ijf (more details), 3 Å
SCOPe Domain Sequences for d1ijfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ijfa1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg vpgdnvgfnvknvsvkeirrgnvcgdakndppkg
Timeline for d1ijfa1: