SCOP 1.75: Domain d1ijfa1: 1ijf A:241-334

Lineage for d1ijfa1 (1ijf A:241-334)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (6 families)

5. Family b.43.3.1: Elongation factors [50448] (10 proteins)

6. Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50455] (6 PDB entries)

8. Domain d1ijfa1: 1ijf A:241-334 [62489]
   Other proteins in same PDB: d1ijfa2, d1ijfa3, d1ijfb_
   complexed with gdp, mg

Details for d1ijfa1

PDB Entry: 1ijf, 3 Å

PDB Description: Nucleotide exchange mechanisms in the eEF1A-eEF1Ba complex

PDB Compounds: (A:) Elongation factor 1-alpha

SCOP Domain Sequences for d1ijfa1:

Sequence; same for both SEQRES and ATOM records:

>d1ijfa1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
vpgdnvgfnvknvsvkeirrgnvcgdakndppkg

Timeline for d1ijfa1:

• d1ijfa1 first appeared in SCOP 1.57
  
• d1ijfa1 appears in SCOP 1.73
  
• d1ijfa1 appears in SCOPe 2.01
  
• d1ijfa1 appears in the current release, SCOPe 2.08