Lineage for d1ijea2 (1ije A:335-441)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952593Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 952594Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 952595Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 952596Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 952597Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50473] (6 PDB entries)
  8. 952601Domain d1ijea2: 1ije A:335-441 [62486]
    Other proteins in same PDB: d1ijea1, d1ijea3, d1ijeb_
    complexed with gdp

Details for d1ijea2

PDB Entry: 1ije (more details), 2.4 Å

PDB Description: nucleotide exchange intermediates in the eef1a-eef1ba complex
PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d1ijea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijea2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
casfnatvivlnhpgqisagyspvldchtahiacrfdellekndrrsgkkledhpkflks
gdaalvkfvpskpmcveafseypplgrfavrdmrqtvavgviksvdk

SCOPe Domain Coordinates for d1ijea2:

Click to download the PDB-style file with coordinates for d1ijea2.
(The format of our PDB-style files is described here.)

Timeline for d1ijea2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ijeb_