Lineage for d1ij9a2 (1ij9 A:1-90)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.4: I set domains [49159] (25 proteins) 
Protein N-terminal domain of vascular cell adhesion molecule-1 (VCAM-1) [49160] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49161] (3 PDB entries) 
Domain d1ij9a2: 1ij9 A:1-90 [62483]
Other proteins in same PDB: d1ij9a1
Details for d1ij9a2
PDB Entry: 1ij9 (more details), 3 Å
PDB Description: Highly Hydrated Human VCAM-1 Fragment
SCOP Domain Sequences for d1ij9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ij9a2 b.1.1.4 (A:1-90) N-terminal domain of vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens)}
fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
vsfgnehsylctatcesrklekgiqveiys
SCOP Domain Coordinates for d1ij9a2:
Click to download the PDB-style file with coordinates for d1ij9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ij9a2:
- d1ij9a2 first appeared in SCOP 1.57
- d1ij9a2 appears in SCOP 1.61
- d1ij9a2 appears in the current release, SCOPe 2.08
View in 3D
