Lineage for d1ij8a_ (1ij8 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 301239Fold b.61: Streptavidin-like [50875] (5 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 301240Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 301241Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 301242Protein Avidin [50880] (1 species)
  7. 301243Species Chicken (Gallus gallus) [TaxId:9031] [50881] (10 PDB entries)
  8. 301246Domain d1ij8a_: 1ij8 A: [62480]

Details for d1ij8a_

PDB Entry: 1ij8 (more details), 2 Å

PDB Description: crystal structure of lite avidin-bni complex

SCOP Domain Sequences for d1ij8a_:

Sequence, based on SEQRES records: (download)

>d1ij8a_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus)}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

Sequence, based on observed residues (ATOM records): (download)

>d1ij8a_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus)}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtneikesplhgtentinkrtqptfg
ftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl

SCOP Domain Coordinates for d1ij8a_:

Click to download the PDB-style file with coordinates for d1ij8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ij8a_: