Lineage for d1ij3b_ (1ij3 B:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 344850Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 344989Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 344990Family h.1.3.1: Leucine zipper domain [57960] (14 proteins)
  6. 345042Protein GCN4 [57961] (1 species)
  7. 345043Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (23 PDB entries)
  8. 345068Domain d1ij3b_: 1ij3 B: [62478]

Details for d1ij3b_

PDB Entry: 1ij3 (more details), 1.8 Å

PDB Description: gcn4-pvsl coiled-coil trimer with serine at the a(16) position

SCOP Domain Sequences for d1ij3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ij3b_ h.1.3.1 (B:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveellsksyhlenevarlkklvg

SCOP Domain Coordinates for d1ij3b_:

Click to download the PDB-style file with coordinates for d1ij3b_.
(The format of our PDB-style files is described here.)

Timeline for d1ij3b_: