Lineage for d1ij2a_ (1ij2 A:)

  1. Root: SCOP 1.69
  2. 525081Class h: Coiled coil proteins [57942] (6 folds)
  3. 525082Fold h.1: Parallel coiled-coil [57943] (28 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 525237Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 525238Family h.1.3.1: Leucine zipper domain [57960] (14 proteins)
  6. 525292Protein GCN4 [57961] (1 species)
  7. 525293Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (33 PDB entries)
  8. 525330Domain d1ij2a_: 1ij2 A: [62474]

Details for d1ij2a_

PDB Entry: 1ij2 (more details), 1.7 Å

PDB Description: gcn4-pvtl coiled-coil trimer with threonine at the a(16) position

SCOP Domain Sequences for d1ij2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ij2a_ h.1.3.1 (A:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveellsktyhlenevarlkklv

SCOP Domain Coordinates for d1ij2a_:

Click to download the PDB-style file with coordinates for d1ij2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ij2a_: