Lineage for d1ij0c_ (1ij0 C:)

  1. Root: SCOP 1.69
  2. 525081Class h: Coiled coil proteins [57942] (6 folds)
  3. 525082Fold h.1: Parallel coiled-coil [57943] (28 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 525237Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 525238Family h.1.3.1: Leucine zipper domain [57960] (14 proteins)
  6. 525292Protein GCN4 [57961] (1 species)
  7. 525293Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (33 PDB entries)
  8. 525329Domain d1ij0c_: 1ij0 C: [62470]
    trimeric mutant

Details for d1ij0c_

PDB Entry: 1ij0 (more details), 1.86 Å

PDB Description: coiled coil trimer gcn4-pvls ser at buried d position

SCOP Domain Sequences for d1ij0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ij0c_ h.1.3.1 (C:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveeslskvyhlenevarlkklvg

SCOP Domain Coordinates for d1ij0c_:

Click to download the PDB-style file with coordinates for d1ij0c_.
(The format of our PDB-style files is described here.)

Timeline for d1ij0c_: