Lineage for d1iixc2 (1iix C:87-171)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 290223Family b.1.1.4: I set domains [49159] (29 proteins)
  6. 290242Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 290251Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries)
  8. 290259Domain d1iixc2: 1iix C:87-171 [62467]
    Other proteins in same PDB: d1iixa1, d1iixa2, d1iixb1, d1iixb2
    complexed with fuc, man, nag

Details for d1iixc2

PDB Entry: 1iix (more details), 3.5 Å

PDB Description: Crystal Structure of a Human Fcg Receptor in Complex with an Fc Fragment of IgG1 (hexagonal)

SCOP Domain Sequences for d1iixc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iixc2 b.1.1.4 (C:87-171) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III}
higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkdrkyfhhnsdfhipkatl
kdsgsyfcrglvgsknvssetvnit

SCOP Domain Coordinates for d1iixc2:

Click to download the PDB-style file with coordinates for d1iixc2.
(The format of our PDB-style files is described here.)

Timeline for d1iixc2: