Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (29 proteins) |
Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species) possibly an intermediate structure between the I set and FnIII domains |
Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries) |
Domain d1iixc2: 1iix C:87-171 [62467] Other proteins in same PDB: d1iixa1, d1iixa2, d1iixb1, d1iixb2 complexed with fuc, man, nag |
PDB Entry: 1iix (more details), 3.5 Å
SCOP Domain Sequences for d1iixc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iixc2 b.1.1.4 (C:87-171) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III} higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkdrkyfhhnsdfhipkatl kdsgsyfcrglvgsknvssetvnit
Timeline for d1iixc2:
View in 3D Domains from other chains: (mouse over for more information) d1iixa1, d1iixa2, d1iixb1, d1iixb2 |