Lineage for d1iixb2 (1iix B:342-443)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104421Species Fc (human) IgG1 class [49120] (8 PDB entries)
  8. 104441Domain d1iixb2: 1iix B:342-443 [62465]
    Other proteins in same PDB: d1iixc1, d1iixc2

Details for d1iixb2

PDB Entry: 1iix (more details), 3.5 Å

PDB Description: Crystal Structure of a Human Fcg Receptor in Complex with an Fc Fragment of IgG1 (hexagonal)

SCOP Domain Sequences for d1iixb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iixb2 b.1.1.2 (B:342-443) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOP Domain Coordinates for d1iixb2:

Click to download the PDB-style file with coordinates for d1iixb2.
(The format of our PDB-style files is described here.)

Timeline for d1iixb2: