SCOP 1.61: Domain d1iixb1: 1iix B:231-341

Lineage for d1iixb1 (1iix B:231-341)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fc (human) IgG1 class [49120] (9 PDB entries)

8. Domain d1iixb1: 1iix B:231-341 [62464]
   Other proteins in same PDB: d1iixc1, d1iixc2

Details for d1iixb1

PDB Entry: 1iix, 3.5 Å

PDB Description: Crystal Structure of a Human Fcg Receptor in Complex with an Fc Fragment of IgG1 (hexagonal)

SCOP Domain Sequences for d1iixb1:

Sequence; same for both SEQRES and ATOM records:

>d1iixb1 b.1.1.2 (B:231-341) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
apellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktk
preqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

Timeline for d1iixb1:

• d1iixb1 first appeared in SCOP 1.57
  
• d1iixb1 appears in SCOP 1.59
  
• d1iixb1 appears in SCOP 1.63
  
• d1iixb1 last appears in SCOP 1.71