Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Glutamate receptor ligand binding core [53881] (5 species) |
Species Synechocystis sp., GluR0 [TaxId:1143] [64192] (3 PDB entries) |
Domain d1iita1: 1iit A:6-226 [62460] Other proteins in same PDB: d1iita2 complexed with ser |
PDB Entry: 1iit (more details), 1.9 Å
SCOPe Domain Sequences for d1iita1:
Sequence, based on SEQRES records: (download)
>d1iita1 c.94.1.1 (A:6-226) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} lkvgvvgnppfvfygegknaaftgisldvwravaesqkwnseyvrqnsisagitavaege ldiligpisvtperaaiegitftqpyfssgigllipgtatplfrsvgdlknkevavvrdt tavdwanfyqadvretnnltaaitllqkkqveavmfdrpaliyytrqnpnlnlevteirv slepygfvlkensplqktinvemlnllysrviaefterwlg
>d1iita1 c.94.1.1 (A:6-226) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} lkvgvvgnppfvfygaftgisldvwravaesqkwnseyvrqnsisagitavaegeldili gpisvtperaaiegitftqpyfssgigllipgtatplfrsvgdlknkevavvrdttavdw anfyqadvretnnltaaitllqkkqveavmfdrpaliyytrqnpnlnlevteirvslepy gfvlkensplqktinvemlnllysrviaefterwlg
Timeline for d1iita1: