Lineage for d1iita1 (1iit A:6-226)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913863Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2914287Species Synechocystis sp., GluR0 [TaxId:1143] [64192] (3 PDB entries)
  8. 2914289Domain d1iita1: 1iit A:6-226 [62460]
    Other proteins in same PDB: d1iita2
    complexed with ser

Details for d1iita1

PDB Entry: 1iit (more details), 1.9 Å

PDB Description: glur0 ligand binding core complex with l-serine
PDB Compounds: (A:) Slr1257 protein

SCOPe Domain Sequences for d1iita1:

Sequence, based on SEQRES records: (download)

>d1iita1 c.94.1.1 (A:6-226) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]}
lkvgvvgnppfvfygegknaaftgisldvwravaesqkwnseyvrqnsisagitavaege
ldiligpisvtperaaiegitftqpyfssgigllipgtatplfrsvgdlknkevavvrdt
tavdwanfyqadvretnnltaaitllqkkqveavmfdrpaliyytrqnpnlnlevteirv
slepygfvlkensplqktinvemlnllysrviaefterwlg

Sequence, based on observed residues (ATOM records): (download)

>d1iita1 c.94.1.1 (A:6-226) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]}
lkvgvvgnppfvfygaftgisldvwravaesqkwnseyvrqnsisagitavaegeldili
gpisvtperaaiegitftqpyfssgigllipgtatplfrsvgdlknkevavvrdttavdw
anfyqadvretnnltaaitllqkkqveavmfdrpaliyytrqnpnlnlevteirvslepy
gfvlkensplqktinvemlnllysrviaefterwlg

SCOPe Domain Coordinates for d1iita1:

Click to download the PDB-style file with coordinates for d1iita1.
(The format of our PDB-style files is described here.)

Timeline for d1iita1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iita2