Lineage for d1iisc2 (1iis C:87-171)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160385Family b.1.1.4: I set domains [49159] (25 proteins)
  6. 160398Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
  7. 160407Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries)
  8. 160413Domain d1iisc2: 1iis C:87-171 [62459]
    Other proteins in same PDB: d1iisa1, d1iisa2, d1iisb1, d1iisb2

Details for d1iisc2

PDB Entry: 1iis (more details), 3 Å

PDB Description: Crystal Structure of a Human Fcg Receptor in Complex with an Fc Fragment of IgG1 (orthorhombic)

SCOP Domain Sequences for d1iisc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iisc2 b.1.1.4 (C:87-171) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III}
higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkdrkyfhhnsdfhipkatl
kdsgsyfcrglvgsknvssetvnit

SCOP Domain Coordinates for d1iisc2:

Click to download the PDB-style file with coordinates for d1iisc2.
(The format of our PDB-style files is described here.)

Timeline for d1iisc2: