Lineage for d1iisb1 (1iis B:232-341)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453802Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 453803Species Human (Homo sapiens) [TaxId:9606] [88585] (22 PDB entries)
  8. 453826Domain d1iisb1: 1iis B:232-341 [62456]
    Other proteins in same PDB: d1iisa2, d1iisb2, d1iisc1, d1iisc2
    part of a Fc

Details for d1iisb1

PDB Entry: 1iis (more details), 3 Å

PDB Description: Crystal Structure of a Human Fcg Receptor in Complex with an Fc Fragment of IgG1 (orthorhombic)

SCOP Domain Sequences for d1iisb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iisb1 b.1.1.2 (B:232-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)}
pellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvevhnaktkp
reeqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

SCOP Domain Coordinates for d1iisb1:

Click to download the PDB-style file with coordinates for d1iisb1.
(The format of our PDB-style files is described here.)

Timeline for d1iisb1: