Lineage for d1iira_ (1iir A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142395Family c.87.1.5: Gtf glycosyltransferase [64178] (3 protein domains)
    Glycosyltransferase family 28
  6. 2142408Protein UDP-glucosyltransferase GtfB [64179] (1 species)
  7. 2142409Species Amycolatopsis orientalis [TaxId:31958] [64180] (1 PDB entry)
  8. 2142410Domain d1iira_: 1iir A: [62453]
    complexed with mg, so4

Details for d1iira_

PDB Entry: 1iir (more details), 1.8 Å

PDB Description: Crystal Structure of UDP-glucosyltransferase GtfB
PDB Compounds: (A:) glycosyltransferase GtfB

SCOPe Domain Sequences for d1iira_:

Sequence, based on SEQRES records: (download)

>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]}
mrvllatcgsrgdteplvalavrvrdlgadvrmcappdcaerlaevgvphvpvgpsarap
iqrakpltaedvrrftteaiatqfdeipaaaegcaavvttgllaaaigvrsvaeklgipy
fyafhcpsyvpspyypppplgepstqdtidipaqwernnqsayqryggllnshrdaiglp
pvediftfgytdhpwvaadpvlaplqptdldavqtgawilpderplspelaafldagppp
vylgfgslgapadavrvaidairahgrrvilsrgwadlvlpddgadcfaigevnhqvlfg
rvaavihhggagtthvaaragapqillpqmadqpyyagrvaelgvgvahdgpiptfdsls
aalataltpetharatavagtirtdgaavaarllldavsre

Sequence, based on observed residues (ATOM records): (download)

>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]}
mrvllatcgsrgdteplvalavrvrdlgadvrmcappdcaerlaevgvphvpvgprakpl
taedvrrftteaiatqfdeipaaaegcaavvttgllaaaigvrsvaeklgipyfyafhcp
syvpspyyppppidipaqwernnqsayqryggllnshrdaiglppvediftfgytdhpwv
aadpvlaplqptdldavqtgawilpderplspelaafldagpppvylgfgapadavrvai
dairahgrrvilsrgwadlvlpddgadcfaigevnhqvlfgrvaavihhggagtthvaar
agapqillpqmadqpyyagrvaelgvgvahdgpiptfdslsaalataltpetharatava
gtirtdgaavaarllldavsre

SCOPe Domain Coordinates for d1iira_:

Click to download the PDB-style file with coordinates for d1iira_.
(The format of our PDB-style files is described here.)

Timeline for d1iira_: