SCOPe 2.05: Domain d1iipa2: 1iip A:2-196

Lineage for d1iipa2 (1iip A:2-196)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Cyclophilin 40 isomerase domain [63814] (1 species)
   the other domain is formed by TPR repeats

7. Species Cow (Bos taurus) [TaxId:9913] [63815] (2 PDB entries)

8. Domain d1iipa2: 1iip A:2-196 [62452]
   Other proteins in same PDB: d1iipa1
   complexed with gol

Details for d1iipa2

PDB Entry: 1iip, 2 Å

PDB Description: Bovine Cyclophilin 40, Tetragonal Form

PDB Compounds: (A:) Cyclophilin 40

SCOPe Domain Sequences for d1iipa2:

Sequence; same for both SEQRES and ATOM records:

>d1iipa2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]}
shpspqakpsnpsnprvffdvdiggervgrivlelfadivpktaenfralctgekgigpt
tgkplhfkgcpfhriikkfmiqggdfsnqngtggesiygekfedenfhykhdkegllsma
nagsntngsqffittvptphldgkhvvfgqvikgmgvakilenvevkgekpaklcviaec
gelkegddwgifpkd

Timeline for d1iipa2:

• d1iipa2 first appeared in SCOP 1.57
  
• d1iipa2 appears in SCOPe 2.04
  
• d1iipa2 appears in SCOPe 2.06
  
• d1iipa2 appears in the current release, SCOPe 2.08