![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
![]() | Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) ![]() |
![]() | Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins) |
![]() | Protein Cyclophilin 40 isomerase domain [63814] (1 species) the other domain is formed by TPR repeats |
![]() | Species Cow (Bos taurus) [TaxId:9913] [63815] (2 PDB entries) |
![]() | Domain d1iipa2: 1iip A:2-196 [62452] Other proteins in same PDB: d1iipa1 complexed with gol |
PDB Entry: 1iip (more details), 2 Å
SCOP Domain Sequences for d1iipa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iipa2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus)} shpspqakpsnpsnprvffdvdiggervgrivlelfadivpktaenfralctgekgigpt tgkplhfkgcpfhriikkfmiqggdfsnqngtggesiygekfedenfhykhdkegllsma nagsntngsqffittvptphldgkhvvfgqvikgmgvakilenvevkgekpaklcviaec gelkegddwgifpkd
Timeline for d1iipa2: