![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (9 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein Cyclophilin 40 [63618] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [63619] (2 PDB entries) |
![]() | Domain d1iipa1: 1iip A:197-298 [62451] Other proteins in same PDB: d1iipa2 truncated form(?); adopts a different fold complexed with gol |
PDB Entry: 1iip (more details), 2 Å
SCOPe Domain Sequences for d1iipa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iipa1 a.118.8.1 (A:197-298) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} gsgdshpdfpedadvdlkdvdkillisedlknigntffksqnwemaikkytkvlryvegs raaaedadgaklqpvalscvlnigacklkmsdwqgavdscle
Timeline for d1iipa1: