Lineage for d1iipa1 (1iip A:197-298)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155820Fold a.118: alpha-alpha superhelix [48370] (16 superfamilies)
  4. 156007Superfamily a.118.8: TPR-like [48452] (2 families) (S)
  5. 156008Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (6 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 156009Protein Cyclophilin 40 [63618] (1 species)
  7. 156010Species Cow (Bos taurus) [TaxId:9913] [63619] (2 PDB entries)
  8. 156012Domain d1iipa1: 1iip A:197-298 [62451]
    Other proteins in same PDB: d1iipa2

Details for d1iipa1

PDB Entry: 1iip (more details), 2 Å

PDB Description: Bovine Cyclophilin 40, Tetragonal Form

SCOP Domain Sequences for d1iipa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iipa1 a.118.8.1 (A:197-298) Cyclophilin 40 {Cow (Bos taurus)}
gsgdshpdfpedadvdlkdvdkillisedlknigntffksqnwemaikkytkvlryvegs
raaaedadgaklqpvalscvlnigacklkmsdwqgavdscle

SCOP Domain Coordinates for d1iipa1:

Click to download the PDB-style file with coordinates for d1iipa1.
(The format of our PDB-style files is described here.)

Timeline for d1iipa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iipa2