SCOPe 2.05: Domain d1iilh2: 1iil H:251-364

Lineage for d1iilh2 (1iil H:251-364)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.4: I set domains [49159] (39 proteins)
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (10 PDB entries)
Domain d1iilh2: 1iil H:251-364 [62444]
Other proteins in same PDB: d1iila_, d1iilb_, d1iilc_, d1iild_
mutant

Details for d1iilh2

PDB Entry: 1iil (more details), 2.3 Å

PDB Description: crystal structure of pro253arg apert mutant fgf receptor 2 (fgfr2) in complex with fgf2

PDB Compounds: (H:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d1iilh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iilh2 b.1.1.4 (H:251-364) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvlpapg

SCOPe Domain Coordinates for d1iilh2:

Click to download the PDB-style file with coordinates for d1iilh2.
(The format of our PDB-style files is described here.)

Timeline for d1iilh2: