SCOP 1.57: Domain d1iilh2: 1iil H:251-364

Lineage for d1iilh2 (1iil H:251-364)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (22 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)

7. Species Human (Homo sapiens), FGFR2 [TaxId:9606] [49181] (5 PDB entries)

8. Domain d1iilh2: 1iil H:251-364 [62444]
   Other proteins in same PDB: d1iila_, d1iilb_, d1iilc_, d1iild_

Details for d1iilh2

PDB Entry: 1iil, 2.3 Å

PDB Description: crystal structure of pro253arg apert mutant fgf receptor 2 (fgfr2) in complex with fgf2

SCOP Domain Sequences for d1iilh2:

Sequence; same for both SEQRES and ATOM records:

>d1iilh2 b.1.1.4 (H:251-364) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2}
rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvlpapg

Timeline for d1iilh2:

• d1iilh2 is new in SCOP 1.57
  
• d1iilh2 appears in SCOP 1.59
  
• d1iilh2 appears in the current release, SCOPe 2.08