Lineage for d1iilg2 (1iil G:251-364)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764414Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1764483Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. 1764497Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (10 PDB entries)
  8. 1764518Domain d1iilg2: 1iil G:251-364 [62442]
    Other proteins in same PDB: d1iila_, d1iilb_, d1iilc_, d1iild_
    mutant

Details for d1iilg2

PDB Entry: 1iil (more details), 2.3 Å

PDB Description: crystal structure of pro253arg apert mutant fgf receptor 2 (fgfr2) in complex with fgf2
PDB Compounds: (G:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d1iilg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iilg2 b.1.1.4 (G:251-364) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvlpapg

SCOPe Domain Coordinates for d1iilg2:

Click to download the PDB-style file with coordinates for d1iilg2.
(The format of our PDB-style files is described here.)

Timeline for d1iilg2: