SCOPe 2.01: Domain d1iilf1: 1iil F:150-250

Lineage for d1iilf1 (1iil F:150-250)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.4: I set domains [49159] (39 proteins)
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (7 PDB entries)
Domain d1iilf1: 1iil F:150-250 [62439]
Other proteins in same PDB: d1iila_, d1iilb_, d1iilc_, d1iild_
mutant

Details for d1iilf1

PDB Entry: 1iil (more details), 2.3 Å

PDB Description: crystal structure of pro253arg apert mutant fgf receptor 2 (fgfr2) in complex with fgf2

PDB Compounds: (F:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d1iilf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iilf1 b.1.1.4 (F:150-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvve

SCOPe Domain Coordinates for d1iilf1:

Click to download the PDB-style file with coordinates for d1iilf1.
(The format of our PDB-style files is described here.)

Timeline for d1iilf1: