Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (32 proteins) |
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) |
Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (5 PDB entries) |
Domain d1iilf1: 1iil F:150-250 [62439] Other proteins in same PDB: d1iila_, d1iilb_, d1iilc_, d1iild_ |
PDB Entry: 1iil (more details), 2.3 Å
SCOP Domain Sequences for d1iilf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iilf1 b.1.1.4 (F:150-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a} nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvve
Timeline for d1iilf1: