Lineage for d1iigb_ (1iig B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089715Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2089716Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2089717Protein Triosephosphate isomerase [51353] (20 species)
  7. 2089953Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)
  8. 2090012Domain d1iigb_: 1iig B: [62429]
    complexed with 3pp

Details for d1iigb_

PDB Entry: 1iig (more details), 2.6 Å

PDB Description: structure of trypanosoma brucei brucei triosephosphate isomerase complexed with 3-phosphonopropionate
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d1iigb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iigb_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq

SCOPe Domain Coordinates for d1iigb_:

Click to download the PDB-style file with coordinates for d1iigb_.
(The format of our PDB-style files is described here.)

Timeline for d1iigb_: