![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein) duplication: consists of two NAT-like domains swapped with the C-terminal strands |
![]() | Protein N-myristoyl transferase, NMT [55749] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55750] (3 PDB entries) |
![]() | Domain d1iida1: 1iid A:34-218 [62426] complex with s-(2-oxo)pentadecyl-CoA and the octapeptide complexed with nhm, ni |
PDB Entry: 1iid (more details), 2.5 Å
SCOPe Domain Sequences for d1iida1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iida1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} amkdhkfwrtqpvkdfdekvveegpidkpktpedisdkplpllssfewcsidvdnkkqle dvfvllnenyvedrdagfrfnytkeffnwalkspgwkkdwhigvrvketqklvafisaip vtlgvrgkqvpsveinflcvhkqlrskrltpvlikeitrrvnkcdiwhalytagivlpap vstcr
Timeline for d1iida1: